PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009624128.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 289aa    MW: 32637.5 Da    PI: 6.5274
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009624128.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.82.9e-5581341129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lp GfrFhPtdeel+++yL++kv++ ++++  ++++vd++k+ePwdLp+k++ +ekewyfFs +d+ky+tg r+nrat++gyWk+tgkdke+++ 
  XP_009624128.1   8 LPSGFRFHPTDEELITYYLRNKVSDFSFTA-AAFADVDLNKCEPWDLPAKASMGEKEWYFFSLKDRKYPTGLRTNRATEAGYWKTTGKDKEIFH- 100
                     699************************999.78***************999999****************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +g l+g+kktLvfy+grapkgekt+W+mheyrle
  XP_009624128.1 101 GGVLIGMKKTLVFYRGRAPKGEKTNWIMHEYRLE 134
                     ********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.11E-636154IPR003441NAC domain
PROSITE profilePS5100559.1358154IPR003441NAC domain
PfamPF023651.9E-289133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MEEINNKLPS GFRFHPTDEE LITYYLRNKV SDFSFTAAAF ADVDLNKCEP WDLPAKASMG  60
EKEWYFFSLK DRKYPTGLRT NRATEAGYWK TTGKDKEIFH GGVLIGMKKT LVFYRGRAPK  120
GEKTNWIMHE YRLETELGFK PSKEEWVVCR VFQKSPTVKK PNPTSSQSQE SPNCDTNYTI  180
ANEIIGDFEL SNLSSIATPS SGISNISLQN YNNENMNMNL ASAATRSEAA SNNIVPLLPN  240
WSSSLLSSNY LSSSVNSLLF SSLQSRVNYH TKEAATNIGD YFVNDFTLD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-55816017171NO APICAL MERISTEM PROTEIN
1ut4_B5e-55816017171NO APICAL MERISTEM PROTEIN
1ut7_A5e-55816017171NO APICAL MERISTEM PROTEIN
1ut7_B5e-55816017171NO APICAL MERISTEM PROTEIN
3swm_A6e-55816020174NAC domain-containing protein 19
3swm_B6e-55816020174NAC domain-containing protein 19
3swm_C6e-55816020174NAC domain-containing protein 19
3swm_D6e-55816020174NAC domain-containing protein 19
3swp_A6e-55816020174NAC domain-containing protein 19
3swp_B6e-55816020174NAC domain-containing protein 19
3swp_C6e-55816020174NAC domain-containing protein 19
3swp_D6e-55816020174NAC domain-containing protein 19
4dul_A5e-55816017171NAC domain-containing protein 19
4dul_B5e-55816017171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF5102121e-161AF510212.1 Petunia x hybrida nam-like protein 15 (NH15) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009624128.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ22e-81NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0J8CAG61e-121A0A0J8CAG6_BETVU; Uncharacterized protein
STRINGPOPTR_0015s03700.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-86NAC domain containing protein 58